CHST2 antibody

Catalog No. ABIN635427

Product Details anti-CHST2 Antibody

Target: CHST2 (Carbohydrate (N-Acetylglucosamine-6-O) Sulfotransferase 2 (CHST2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHST2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: CHST2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHST2 Blocking Peptide, catalog no. 33R-6649, is also available for use as a blocking control in assays to test for specificity of this CHST2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHST2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHST2

Target: CHST2 (Carbohydrate (N-Acetylglucosamine-6-O) Sulfotransferase 2 (CHST2))

Alternative Name: CHST2 (CHST2 Products)

Synonyms: chst2 antibody, wu:fj55f04 antibody, zgc:154070 antibody, CHST2 antibody, C6ST antibody, GST-2 antibody, GST2 antibody, Gn6ST-1 antibody, glcNAc6ST-1 antibody, AI428561 antibody, AW121776 antibody, C130041E03Rik antibody, Chts2 antibody, GlcNAc6ST antibody, Gn6st antibody, carbohydrate sulfotransferase 2 antibody, carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2a antibody, carbohydrate sulfotransferase 4 antibody, carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2 antibody, carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2 L homeolog antibody, CHST2 antibody, chst2a antibody, CHST4 antibody, chst2 antibody, chst2.L antibody, Chst2 antibody

Background: N-acetylglucosamine-6-O-sulfotransferases, such as CHST2, catalyze the transfer of sulfate from 3-prime-phosphoadenosine 5-prime-phosphosulfate (PAPS) to position 6 of a nonreducing N-acetylglucosamine (GlcNAc) residue.

Molecular Weight: 58 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process