DEGS1 antibody

Catalog No. ABIN635423

Product Details anti-DEGS1 Antibody

Target: DEGS1 (Sphingolipid Delta(4)-Desaturase DES1 (DEGS1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DEGS1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DEGS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DEGS1 Blocking Peptide, catalog no. 33R-3584, is also available for use as a blocking control in assays to test for specificity of this DEGS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DEGS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DEGS1

Target: DEGS1 (Sphingolipid Delta(4)-Desaturase DES1 (DEGS1))

Alternative Name: DEGS1 (DEGS1 Products)

Synonyms: DEGS antibody, DEGS-1 antibody, DES1 antibody, Des-1 antibody, FADS7 antibody, MLD antibody, degs antibody, im:6909319 antibody, wu:fa25h01 antibody, wu:fb81d06 antibody, Degs antibody, AA536663 antibody, Des1 antibody, Mdes antibody, delta 4-desaturase, sphingolipid 1 antibody, delta(4)-desaturase, sphingolipid 1 antibody, DEGS1 antibody, degs1 antibody, Degs1 antibody

Background: DEGS1 is a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this protein inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor.

Molecular Weight: 38 kDa (MW of target protein)