Ribophorin II antibody (Middle Region)
-
- Target See all Ribophorin II (RPN2) Antibodies
- Ribophorin II (RPN2)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Ribophorin II antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Ribophorin II antibody was raised against the middle region of RPN2
- Purification
- Affinity purified
- Immunogen
- Ribophorin II antibody was raised using the middle region of RPN2 corresponding to a region with amino acids IKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSP
- Top Product
- Discover our top product RPN2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Ribophorin II Blocking Peptide, catalog no. 33R-4018, is also available for use as a blocking control in assays to test for specificity of this Ribophorin II antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPN2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Ribophorin II (RPN2)
- Alternative Name
- Ribophorin II (RPN2 Products)
- Synonyms
- RIBIIR antibody, RPN-II antibody, RPNII antibody, SWP1 antibody, RPN2 antibody, 1300012C06Rik antibody, AV261018 antibody, Rpn-2 antibody, fb95d11 antibody, fj62b10 antibody, wu:fb61f08 antibody, wu:fb74e07 antibody, wu:fb95d11 antibody, wu:fj41f11 antibody, wu:fj62b10 antibody, rpn2 antibody, ribophorin II antibody, dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 antibody, ribophorin II S homeolog antibody, RPN2 antibody, Rpn2 antibody, rpn2 antibody, LOC5579328 antibody, Bm1_30625 antibody, rpn2.S antibody
- Background
- RPN2 is a type I integral membrane protein found only in the rough endoplasmic reticulum.
- Molecular Weight
- 67 kDa (MW of target protein)
-