Integrin beta 5 antibody (Middle Region)
-
- Target See all Integrin beta 5 (ITGB5) Antibodies
- Integrin beta 5 (ITGB5)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Integrin beta 5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Integrin Beta 5 antibody was raised against the middle region of ITGB5
- Purification
- Affinity purified
- Immunogen
- Integrin Beta 5 antibody was raised using the middle region of ITGB5 corresponding to a region with amino acids LFFTATCQDGVSYPGQRKCEGLKIGDTASFEVSLEARSCPSRHTEHVFAL
- Top Product
- Discover our top product ITGB5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Integrin Beta 5 Blocking Peptide, catalog no. 33R-4936, is also available for use as a blocking control in assays to test for specificity of this Integrin Beta 5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGB5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Integrin beta 5 (ITGB5)
- Alternative Name
- Integrin beta 5 (ITGB5 Products)
- Synonyms
- ITGB5 antibody, AA475909 antibody, AI874634 antibody, ESTM23 antibody, [b]-5 antibody, [b]5 antibody, [b]5A antibody, [b]5B antibody, beta-5 antibody, beta5 antibody, RGD1563276 antibody, integrin, beta 5 antibody, integrin beta 5 antibody, integrin subunit beta 5 antibody, ITGB5 antibody, Itgb5 antibody
- Background
- Integrin alpha-V/beta-5 is a receptor for fibronectin. It recognises the sequence R-G-D in its ligand.
- Molecular Weight
- 88 kDa (MW of target protein)
- Pathways
- Integrin Complex
-