C1orf151 antibody (Middle Region)
-
- Target See all C1orf151 Antibodies
- C1orf151 (Chromosome 1 Open Reading Frame 151 (C1orf151))
-
Binding Specificity
- Middle Region
-
Reactivity
- Mouse, Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C1orf151 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C1 ORF151 antibody was raised against the middle region of C1 rf151
- Purification
- Affinity purified
- Immunogen
- C1 ORF151 antibody was raised using the middle region of C1 rf151 corresponding to a region with amino acids IVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ
- Top Product
- Discover our top product C1orf151 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C1ORF151 Blocking Peptide, catalog no. 33R-4197, is also available for use as a blocking control in assays to test for specificity of this C1ORF151 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF151 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C1orf151 (Chromosome 1 Open Reading Frame 151 (C1orf151))
- Alternative Name
- C1ORF151 (C1orf151 Products)
- Background
- The function of C1orf151 protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 9 kDa (MW of target protein)
-