C1orf151 antibody (Middle Region)

Catalog No. ABIN635405

Product Details anti-C1orf151 Antibody

Target: C1orf151 (Chromosome 1 Open Reading Frame 151 (C1orf151))

Binding Specificity: Middle Region

Reactivity: Mouse, Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C1orf151 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C1 ORF151 antibody was raised against the middle region of C1 rf151

Purification: Affinity purified

Immunogen: C1 ORF151 antibody was raised using the middle region of C1 rf151 corresponding to a region with amino acids IVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C1ORF151 Blocking Peptide, catalog no. 33R-4197, is also available for use as a blocking control in assays to test for specificity of this C1ORF151 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF151 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C1orf151

Target: C1orf151 (Chromosome 1 Open Reading Frame 151 (C1orf151))

Alternative Name: C1ORF151 (C1orf151 Products)

Synonyms: C1orf151 antibody, MIO10 antibody, RGD1560187 antibody, 2310028O11Rik antibody, mitochondrial inner membrane organizing system 1 antibody, MINOS1 antibody, Minos1 antibody

Background: The function of C1orf151 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 9 kDa (MW of target protein)