C20orf30 antibody (C-Term)
-
- Target See all C20orf30 Antibodies
- C20orf30 (Chromosome 20 Open Reading Frame 30 (C20orf30))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C20orf30 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C20 ORF30 antibody was raised against the C terminal Of C20 rf30
- Purification
- Affinity purified
- Immunogen
- C20 ORF30 antibody was raised using the C terminal Of C20 rf30 corresponding to a region with amino acids KGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD
- Top Product
- Discover our top product C20orf30 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C20ORF30 Blocking Peptide, catalog no. 33R-4391, is also available for use as a blocking control in assays to test for specificity of this C20ORF30 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF30 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C20orf30 (Chromosome 20 Open Reading Frame 30 (C20orf30))
- Alternative Name
- C20ORF30 (C20orf30 Products)
- Synonyms
- MGC89669 antibody, C20orf30 antibody, TMEM230 antibody, c20orf30 antibody, HSPC274 antibody, dJ1116H23.2.1 antibody, C13H20orf30 antibody, RGD1307399 antibody, 5730494N06Rik antibody, AA407821 antibody, transmembrane protein 230 antibody, transmembrane protein 230 L homeolog antibody, tmem230 antibody, TMEM230 antibody, tmem230.L antibody, Tmem230 antibody
- Background
- The function of C20orf30 protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 13 kDa (MW of target protein)
-