ITPRIPL1 antibody (C-Term)

Catalog No. ABIN635393

Product Details anti-ITPRIPL1 Antibody

Target: ITPRIPL1 (Inositol 1,4,5-Triphosphate Receptor Interacting Protein-Like 1 (ITPRIPL1))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ITPRIPL1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KIAA1754 L antibody was raised against the C terminal of KIAA1754

Purification: Affinity purified

Immunogen: KIAA1754 L antibody was raised using the C terminal of KIAA1754 corresponding to a region with amino acids EHLFLKLVGRFAPENTCHLKCLQIILSLRQHQSLPHGASRPILTSYHFKT

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIAA1754L Blocking Peptide, catalog no. 33R-2453, is also available for use as a blocking control in assays to test for specificity of this KIAA1754L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA1750 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ITPRIPL1

Target: ITPRIPL1 (Inositol 1,4,5-Triphosphate Receptor Interacting Protein-Like 1 (ITPRIPL1))

Alternative Name: KIAA1754L (ITPRIPL1 Products)

Synonyms: 1700041B20Rik antibody, KIAA1754L antibody, inositol 1,4,5-triphosphate receptor interacting protein-like 1 antibody, ITPRIP like 1 antibody, inositol 1,4,5-trisphosphate receptor interacting protein-like 1 antibody, Itpripl1 antibody, ITPRIPL1 antibody

Background: The function of KIAA1754L protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 61 kDa (MW of target protein)