NIPA2 antibody (Middle Region)

Catalog No. ABIN635392

Product Details anti-NIPA2 Antibody

Target: NIPA2 (Non Imprinted in Prader-Willi/Angelman Syndrome 2 (NIPA2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NIPA2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NIPA2 antibody was raised against the middle region of NIPA2

Purification: Affinity purified

Immunogen: NIPA2 antibody was raised using the middle region of NIPA2 corresponding to a region with amino acids VYITICSVIGAFSVSCVKGLGIAIKELFAGKPVLRHPLAWILLLSLIVCV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NIPA2 Blocking Peptide, catalog no. 33R-9920, is also available for use as a blocking control in assays to test for specificity of this NIPA2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NIPA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NIPA2

Target: NIPA2 (Non Imprinted in Prader-Willi/Angelman Syndrome 2 (NIPA2))

Alternative Name: NIPA2 (NIPA2 Products)

Synonyms: RGD1306051 antibody, fb72g02 antibody, wu:fb72g02 antibody, zgc:66088 antibody, 2600017P10Rik antibody, 3830408P04Rik antibody, AB041581 antibody, non imprinted in Prader-Willi/Angelman syndrome 2 antibody, non imprinted in Prader-Willi/Angelman syndrome 2 (human) antibody, non imprinted in Prader-Willi/Angelman syndrome 2 homolog (human) antibody, NIPA2 antibody, Nipa2 antibody, nipa2 antibody

Background: NIPA2 belongs to the NIPA family. It is a multi-pass membrane protein. The function of the NIPA2 protein remains unknown.

Molecular Weight: 39 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization