Podoplanin antibody (N-Term)
-
- Target See all Podoplanin (PDPN) Antibodies
- Podoplanin (PDPN)
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Podoplanin antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- Podoplanin antibody was raised against the N terminal of PDPN
- Purification
- Affinity purified
- Immunogen
- Podoplanin antibody was raised using the N terminal of PDPN corresponding to a region with amino acids EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVAT
- Top Product
- Discover our top product PDPN Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Podoplanin Blocking Peptide, catalog no. 33R-2420, is also available for use as a blocking control in assays to test for specificity of this Podoplanin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDPN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Podoplanin (PDPN)
- Alternative Name
- Podoplanin (PDPN Products)
- Synonyms
- PDPN antibody, AGGRUS antibody, GP36 antibody, GP40 antibody, Gp38 antibody, HT1A-1 antibody, OTS8 antibody, PA2.26 antibody, T1A antibody, T1A-2 antibody, OTS-8 antibody, RANDAM-2 antibody, T1-alpha antibody, T1a antibody, T1alpha antibody, E11 antibody, RTI40 antibody, podoplanin antibody, PDPN antibody, Pdpn antibody
- Background
- PDPN is a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a differentiation antigen and influenza-virus receptor. The specific function of this protein has not been determined but it has been proposed as a marker of lung injury.
- Molecular Weight
- 25 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport
-