TMEM195 antibody (N-Term)

Catalog No. ABIN635386

Product Details anti-TMEM195 Antibody

Target: TMEM195 (Transmembrane Protein 195 (TMEM195))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM195 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM195 antibody was raised against the N terminal of TMEM195

Purification: Affinity purified

Immunogen: TMEM195 antibody was raised using the N terminal of TMEM195 corresponding to a region with amino acids MKNPEAQQDVSVSQGFRMLFYTMKPSETSFQTLEEVPDYVKKATPFFISL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM195 Blocking Peptide, catalog no. 33R-6155, is also available for use as a blocking control in assays to test for specificity of this TMEM195 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM195 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM195

Target: TMEM195 (Transmembrane Protein 195 (TMEM195))

Alternative Name: TMEM195 (TMEM195 Products)

Synonyms: TMEM195 antibody, A530016O06Rik antibody, AI790538 antibody, Tmem195 antibody, RGD1312038 antibody, alkylglycerol monooxygenase antibody, AGMO antibody, Agmo antibody

Background: TMEM195 belongs to the TMEM195 family. It is a multi-pass membrane protein.

Molecular Weight: 51 kDa (MW of target protein)