TMEM195 antibody (N-Term)
-
- Target See all TMEM195 Antibodies
- TMEM195 (Transmembrane Protein 195 (TMEM195))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TMEM195 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TMEM195 antibody was raised against the N terminal of TMEM195
- Purification
- Affinity purified
- Immunogen
- TMEM195 antibody was raised using the N terminal of TMEM195 corresponding to a region with amino acids MKNPEAQQDVSVSQGFRMLFYTMKPSETSFQTLEEVPDYVKKATPFFISL
- Top Product
- Discover our top product TMEM195 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TMEM195 Blocking Peptide, catalog no. 33R-6155, is also available for use as a blocking control in assays to test for specificity of this TMEM195 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM195 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMEM195 (Transmembrane Protein 195 (TMEM195))
- Alternative Name
- TMEM195 (TMEM195 Products)
- Synonyms
- TMEM195 antibody, A530016O06Rik antibody, AI790538 antibody, Tmem195 antibody, RGD1312038 antibody, alkylglycerol monooxygenase antibody, AGMO antibody, Agmo antibody
- Background
- TMEM195 belongs to the TMEM195 family. It is a multi-pass membrane protein.
- Molecular Weight
- 51 kDa (MW of target protein)
-