SLC35F3 antibody (Middle Region)

Catalog No. ABIN635380

Product Details anti-SLC35F3 Antibody

Target: SLC35F3 (Solute Carrier Family 35, Member F3 (SLC35F3))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC35F3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLC35 F3 antibody was raised against the middle region of SLC35 3

Purification: Affinity purified

Immunogen: SLC35 F3 antibody was raised using the middle region of SLC35 3 corresponding to a region with amino acids LKVFFTKAAPFGVLWTLTNYLYLHAIKKINTTDVSVLFCCNKAFVFLLSW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC35F3 Blocking Peptide, catalog no. 33R-5111, is also available for use as a blocking control in assays to test for specificity of this SLC35F3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC35F3

Target: SLC35F3 (Solute Carrier Family 35, Member F3 (SLC35F3))

Alternative Name: SLC35F3 (SLC35F3 Products)

Background: SLC35F3 is a multi-pass membrane proteinPotential. It belongs to the SLC35F solute transporter family. SLC35F3 is a putative solute transporter.

Molecular Weight: 55 kDa (MW of target protein)