ABHD12 antibody (Middle Region)

Catalog No. ABIN635357

Product Details anti-ABHD12 Antibody

Target: ABHD12 (Abhydrolase Domain Containing 12 (ABHD12))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ABHD12 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ABHD12 antibody was raised against the middle region of ABHD12

Purification: Affinity purified

Immunogen: ABHD12 antibody was raised using the middle region of ABHD12 corresponding to a region with amino acids CPLLILHAEDDPVVPFQLGRKLYSIAAPARSFRDFKVQFVPFHSDLGYRH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ABHD12 Blocking Peptide, catalog no. 33R-1766, is also available for use as a blocking control in assays to test for specificity of this ABHD12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABHD12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ABHD12

Target: ABHD12 (Abhydrolase Domain Containing 12 (ABHD12))

Alternative Name: ABHD12 (ABHD12 Products)

Synonyms: ABHD12 antibody, 1500011G07Rik antibody, 6330583M11Rik antibody, AI431047 antibody, AW547313 antibody, ABHD12A antibody, BEM46L2 antibody, C20orf22 antibody, PHARC antibody, dJ965G21.2 antibody, abhydrolase domain containing 12 antibody, abhydrolase domain containing 12 S homeolog antibody, ABHD12 antibody, CC1G_02966 antibody, PTRG_02160 antibody, abhd12.S antibody, Abhd12 antibody

Background: ABHD12 may be a regulator of endocannabinoid signaling pathways.

Molecular Weight: 45 kDa (MW of target protein)