AWAT1 antibody (N-Term)
-
- Target See all AWAT1 Antibodies
- AWAT1 (Acyl-CoA Wax Alcohol Acyltransferase 1 (AWAT1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This AWAT1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- AWAT1 antibody was raised against the N terminal of AWAT1
- Purification
- Affinity purified
- Immunogen
- AWAT1 antibody was raised using the N terminal of AWAT1 corresponding to a region with amino acids NWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEA
- Top Product
- Discover our top product AWAT1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
AWAT1 Blocking Peptide, catalog no. 33R-6931, is also available for use as a blocking control in assays to test for specificity of this AWAT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AWAT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AWAT1 (Acyl-CoA Wax Alcohol Acyltransferase 1 (AWAT1))
- Alternative Name
- AWAT1 (AWAT1 Products)
- Background
- The protein encoded by this gene belongs to the diacylglycerol acyltransferase family. It esterifies long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that this enzyme plays a central role in lipid metabolism in skin. Consistent with this observation, this protein is predominantly expressed in the sebaceous gland of the skin.
- Molecular Weight
- 38 kDa (MW of target protein)
-