TM4SF20 antibody (Middle Region)

Catalog No. ABIN635333

Product Details anti-TM4SF20 Antibody

Target: TM4SF20 (Transmembrane 4 L Six Family Member 20 (TM4SF20))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TM4SF20 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TM4 SF20 antibody was raised against the middle region of TM4 F20

Purification: Affinity purified

Immunogen: TM4 SF20 antibody was raised using the middle region of TM4 F20 corresponding to a region with amino acids QALLKGPLMCNSPSNSNANCEFSLKNISDIHPESFNLQWFFNDSCAPPTG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TM4SF20 Blocking Peptide, catalog no. 33R-7465, is also available for use as a blocking control in assays to test for specificity of this TM4SF20 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TM0 F20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TM4SF20

Target: TM4SF20 (Transmembrane 4 L Six Family Member 20 (TM4SF20))

Alternative Name: TM4SF20 (TM4SF20 Products)

Synonyms: pro994 antibody, tcce518 antibody, PRO994 antibody, TCCE518 antibody, 1810018L02Rik antibody, transmembrane 4 L six family member 20 antibody, transmembrane 4 L six family member 20 L homeolog antibody, TM4SF20 antibody, Tm4sf20 antibody, tm4sf20.L antibody, tm4sf20 antibody

Background: TM4SF20 functions as a cellular component of the plasma membrane.

Molecular Weight: 25 kDa (MW of target protein)