TM4SF20 antibody (Middle Region)
-
- Target See all TM4SF20 Antibodies
- TM4SF20 (Transmembrane 4 L Six Family Member 20 (TM4SF20))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TM4SF20 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TM4 SF20 antibody was raised against the middle region of TM4 F20
- Purification
- Affinity purified
- Immunogen
- TM4 SF20 antibody was raised using the middle region of TM4 F20 corresponding to a region with amino acids QALLKGPLMCNSPSNSNANCEFSLKNISDIHPESFNLQWFFNDSCAPPTG
- Top Product
- Discover our top product TM4SF20 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TM4SF20 Blocking Peptide, catalog no. 33R-7465, is also available for use as a blocking control in assays to test for specificity of this TM4SF20 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TM0 F20 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TM4SF20 (Transmembrane 4 L Six Family Member 20 (TM4SF20))
- Alternative Name
- TM4SF20 (TM4SF20 Products)
- Synonyms
- pro994 antibody, tcce518 antibody, PRO994 antibody, TCCE518 antibody, 1810018L02Rik antibody, transmembrane 4 L six family member 20 antibody, transmembrane 4 L six family member 20 L homeolog antibody, TM4SF20 antibody, Tm4sf20 antibody, tm4sf20.L antibody, tm4sf20 antibody
- Background
- TM4SF20 functions as a cellular component of the plasma membrane.
- Molecular Weight
- 25 kDa (MW of target protein)
-