C19orf28 antibody (N-Term)
-
- Target See all C19orf28 products
- C19orf28 (Chromosome 19 Open Reading Frame 28 (C19orf28))
- Binding Specificity
- N-Term
- Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C19orf28 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C19 ORF28 antibody was raised against the N terminal Of C19 rf28
- Purification
- Affinity purified
- Immunogen
- C19 ORF28 antibody was raised using the N terminal Of C19 rf28 corresponding to a region with amino acids MGPGPPAAGAAPSPRPLSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSV
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C19ORF28 Blocking Peptide, catalog no. 33R-6054, is also available for use as a blocking control in assays to test for specificity of this C19ORF28 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF28 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C19orf28 (Chromosome 19 Open Reading Frame 28 (C19orf28))
- Alternative Name
- C19ORF28 (C19orf28 Products)
- Synonyms
- MGC81076 antibody, C19orf28 antibody, PP3501 antibody, F630110N24Rik antibody, Wdt1 antibody, major facilitator superfamily domain containing 12 L homeolog antibody, major facilitator superfamily domain containing 12 antibody, mfsd12.L antibody, mfsd12 antibody, MFSD12 antibody, Mfsd12 antibody
- Background
- The C19ORF28 protein may be involved in transmembrane transport.
- Molecular Weight
- 59 kDa (MW of target protein)
-