C19orf28 antibody (N-Term)

Catalog No. ABIN635321

Product Details anti-C19orf28 Antibody

Target: C19orf28 (Chromosome 19 Open Reading Frame 28 (C19orf28))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C19orf28 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C19 ORF28 antibody was raised against the N terminal Of C19 rf28

Purification: Affinity purified

Immunogen: C19 ORF28 antibody was raised using the N terminal Of C19 rf28 corresponding to a region with amino acids MGPGPPAAGAAPSPRPLSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C19ORF28 Blocking Peptide, catalog no. 33R-6054, is also available for use as a blocking control in assays to test for specificity of this C19ORF28 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF28 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C19orf28

Target: C19orf28 (Chromosome 19 Open Reading Frame 28 (C19orf28))

Alternative Name: C19ORF28 (C19orf28 Products)

Synonyms: MGC81076 antibody, C19orf28 antibody, PP3501 antibody, F630110N24Rik antibody, Wdt1 antibody, major facilitator superfamily domain containing 12 L homeolog antibody, major facilitator superfamily domain containing 12 antibody, mfsd12.L antibody, mfsd12 antibody, MFSD12 antibody, Mfsd12 antibody

Background: The C19ORF28 protein may be involved in transmembrane transport.

Molecular Weight: 59 kDa (MW of target protein)