ACBD4 antibody (N-Term)
-
- Target See all ACBD4 Antibodies
- ACBD4 (Acyl-CoA Binding Domain Containing 4 (ACBD4))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACBD4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ACBD4 antibody was raised against the N terminal of ACBD4
- Purification
- Affinity purified
- Immunogen
- ACBD4 antibody was raised using the N terminal of ACBD4 corresponding to a region with amino acids NSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVI
- Top Product
- Discover our top product ACBD4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ACBD4 Blocking Peptide, catalog no. 33R-6881, is also available for use as a blocking control in assays to test for specificity of this ACBD4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACBD4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACBD4 (Acyl-CoA Binding Domain Containing 4 (ACBD4))
- Alternative Name
- ACBD4 (ACBD4 Products)
- Synonyms
- zgc:85611 antibody, F22F7.13 antibody, F22F7_13 antibody, acyl-CoA binding protein 4 antibody, 2010009P05Rik antibody, 2010015A21Rik antibody, AI849317 antibody, acyl-CoA binding domain containing 4 antibody, acyl-CoA binding protein 4 antibody, acyl-Coenzyme A binding domain containing 4 antibody, ACBD4 antibody, acbd4 antibody, Acbd4 antibody, ACBP4 antibody
- Background
- ACBD4 is a member of the acyl-coenzyme A binding domain containing protein family. All family members contain the conserved acyl-Coenzyme A binding domain, which binds acyl-CoA thiol esters. They are thought to play roles in acyl-CoA dependent lipid metabolism.
- Molecular Weight
- 35 kDa (MW of target protein)
-