FAR2 antibody (C-Term)
-
- Target See all FAR2 Antibodies
- FAR2 (Fatty Acyl CoA Reductase 2 (FAR2))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FAR2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MLSTD1 antibody was raised against the C terminal Of Mlstd1
- Purification
- Affinity purified
- Immunogen
- MLSTD1 antibody was raised using the C terminal Of Mlstd1 corresponding to a region with amino acids WSTYNTEMLMSELSPEDQRVFNFDVRQLNWLEYIENYVLGVKKYLLKEDM
- Top Product
- Discover our top product FAR2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MLSTD1 Blocking Peptide, catalog no. 33R-10019, is also available for use as a blocking control in assays to test for specificity of this MLSTD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MLSTD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAR2 (Fatty Acyl CoA Reductase 2 (FAR2))
- Alternative Name
- MLSTD1 (FAR2 Products)
- Background
- MLSTD1 catalyzes the reduction of fatty acyl-CoA to fatty alcohols. The preferred substrates are C16, C18, C18:1 and C18:2 but low activity can be observed with C10-C14 substrates.
- Molecular Weight
- 59 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-