PGRMC1 antibody (N-Term)
-
- Target See all PGRMC1 Antibodies
- PGRMC1 (Progesterone Receptor Membrane Component 1 (PGRMC1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PGRMC1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- PGRMC1 antibody was raised against the N terminal of PGRMC1
- Purification
- Affinity purified
- Immunogen
- PGRMC1 antibody was raised using the N terminal of PGRMC1 corresponding to a region with amino acids MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQ
- Top Product
- Discover our top product PGRMC1 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PGRMC1 Blocking Peptide, catalog no. 33R-5590, is also available for use as a blocking control in assays to test for specificity of this PGRMC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGRMC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PGRMC1 (Progesterone Receptor Membrane Component 1 (PGRMC1))
- Alternative Name
- PGRMC1 (PGRMC1 Products)
- Synonyms
- MGC89150 antibody, wu:fa94d03 antibody, zgc:103577 antibody, DKFZp469D0815 antibody, HPR6.6 antibody, MPR antibody, AA415812 antibody, PPMR antibody, Vema antibody, 25-Dx antibody, 25Dx antibody, VEMA antibody, progesterone receptor membrane component 1 antibody, pgrmc1 antibody, PGRMC1 antibody, Pgrmc1 antibody
- Background
- Progesterone binding protein is a putative steroid membrane receptor. The protein is expressed predominantly in the liver and kidney.
- Molecular Weight
- 22 kDa (MW of target protein)
-