RRBP1 antibody
-
- Target See all RRBP1 Antibodies
- RRBP1 (Ribosome Binding Protein 1 (RRBP1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RRBP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- RRBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TDVAQSPEAPKQEAPAKKKSGSKKKGPPDADGPLYLPYKTLVSTVGSMVF
- Top Product
- Discover our top product RRBP1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RRBP1 Blocking Peptide, catalog no. 33R-9024, is also available for use as a blocking control in assays to test for specificity of this RRBP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRBP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RRBP1 (Ribosome Binding Protein 1 (RRBP1))
- Alternative Name
- RRBP1 (RRBP1 Products)
- Synonyms
- 1700087N07Rik antibody, 5730465C04Rik antibody, ES/130 antibody, mKIAA1398 antibody, mRRp0 antibody, mRRp1.8 antibody, mRRp10 antibody, mRRp15a antibody, mRRp15b antibody, mRRp16.8 antibody, mRRp2 antibody, mRRp41 antibody, mRRp47 antibody, mRRp5.4 antibody, p180 antibody, ES130 antibody, RRp antibody, hES antibody, P180 antibody, rrbp1 antibody, sb:cb489 antibody, wu:fc47a01 antibody, ribosome binding protein 1 antibody, ribosome binding protein 1 homolog 180kDa (dog) antibody, ribosome binding protein 1b antibody, Rrbp1 antibody, RRBP1 antibody, rrbp1b antibody
- Background
- Analysis of cDNA clones indicates that ribosome binding protein 1 may exist in different forms due to removal of tandem repeats, or partial intraexonic splicing of RRBP1. The form presented here is lacking the canine p180 ribosome-binding domain, NQGKKAEGAQ, which is tandemly repeated close to the N-terminus in other forms that haven't been fully characterized.
- Molecular Weight
- 109 kDa (MW of target protein)
-