ACBD5 antibody (N-Term)

Catalog No. ABIN635304

Product Details anti-ACBD5 Antibody

Target: ACBD5 (Acyl-CoA Binding Domain Containing 5 (ACBD5))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACBD5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ACBD5 antibody was raised against the N terminal of ACBD5

Purification: Affinity purified

Immunogen: ACBD5 antibody was raised using the N terminal of ACBD5 corresponding to a region with amino acids ADTRSVHETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQATEGPCK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACBD5 Blocking Peptide, catalog no. 33R-1108, is also available for use as a blocking control in assays to test for specificity of this ACBD5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACBD5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACBD5

Target: ACBD5 (Acyl-CoA Binding Domain Containing 5 (ACBD5))

Alternative Name: ACBD5 (ACBD5 Products)

Synonyms: MGC89100 antibody, 1300014E15Rik antibody, F15A18.90 antibody, F15A18_90 antibody, acyl-CoA binding protein 5 antibody, zgc:112043 antibody, acyl-CoA binding domain containing 5 antibody, acyl-CoA binding domain containing 5 L homeolog antibody, acyl-Coenzyme A binding domain containing 5 antibody, acyl-CoA binding protein 5 antibody, acyl-CoA binding domain containing 5a antibody, ACBD5 antibody, Acbd5 antibody, acbd5.L antibody, acbd5 antibody, ACBP5 antibody, acbd5a antibody

Background: ACBD5 contains 1 ACB (acyl-CoA-binding) domain. The function of the ACBD5 protein is not known.

Molecular Weight: 55 kDa (MW of target protein)