SLC44A3 antibody (Middle Region)

Catalog No. ABIN635296

Product Details anti-SLC44A3 Antibody

Target: SLC44A3 (Solute Carrier Family 44, Member 3 (SLC44A3))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC44A3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLC44 A3 antibody was raised against the middle region of SLC44 3

Purification: Affinity purified

Immunogen: SLC44 A3 antibody was raised using the middle region of SLC44 3 corresponding to a region with amino acids TFAILIFFWVLWVAVLLSLGTAGAAQVMEGGQVEYKPLSGIRYMWSYHLI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC44A3 Blocking Peptide, catalog no. 33R-9061, is also available for use as a blocking control in assays to test for specificity of this SLC44A3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC44A3

Target: SLC44A3 (Solute Carrier Family 44, Member 3 (SLC44A3))

Alternative Name: SLC44A3 (SLC44A3 Products)

Synonyms: CTL3 antibody, BC010552 antibody, RGD1305808 antibody, solute carrier family 44 member 3 antibody, solute carrier family 44, member 3 antibody, SLC44A3 antibody, slc44a3 antibody, Slc44a3 antibody

Background: SLC44A3 is a multi-pass membrane protein. It belongs to the CTL (choline transporter-like) family. The function of the RBM34 protein remains unknown.

Molecular Weight: 68 kDa (MW of target protein)