SLC44A3 antibody (N-Term)
-
- Target See all SLC44A3 products
- SLC44A3 (Solute Carrier Family 44, Member 3 (SLC44A3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC44A3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SLC44 A3 antibody was raised against the N terminal of SLC44 3
- Purification
- Affinity purified
- Immunogen
- SLC44 A3 antibody was raised using the N terminal of SLC44 3 corresponding to a region with amino acids MGYSVVAGAAGRLLFGYDSFGNMCGKKNSPVEGAPLSGQDMTLKKHVFFM
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC44A3 Blocking Peptide, catalog no. 33R-6087, is also available for use as a blocking control in assays to test for specificity of this SLC44A3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC44A3 (Solute Carrier Family 44, Member 3 (SLC44A3))
- Alternative Name
- SLC44A3 (SLC44A3 Products)
- Synonyms
- CTL3 antibody, BC010552 antibody, RGD1305808 antibody, solute carrier family 44 member 3 antibody, solute carrier family 44, member 3 antibody, SLC44A3 antibody, slc44a3 antibody, Slc44a3 antibody
- Background
- SLC44A3 is a multi-pass membrane protein. It belongs to the CTL (choline transporter-like) family. The function of the RBM34 protein remains unknown.
- Molecular Weight
- 68 kDa (MW of target protein)
-