SLCO2B1 antibody (N-Term)
-
- Target See all SLCO2B1 Antibodies
- SLCO2B1 (Solute Carrier Organic Anion Transporter Family, Member 2B1 (SLCO2B1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLCO2B1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SLCO2 B1 antibody was raised against the N terminal of SLCO2 1
- Purification
- Affinity purified
- Immunogen
- SLCO2 B1 antibody was raised using the N terminal of SLCO2 1 corresponding to a region with amino acids DPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQ
- Top Product
- Discover our top product SLCO2B1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLCO2B1 Blocking Peptide, catalog no. 33R-2111, is also available for use as a blocking control in assays to test for specificity of this SLCO2B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLCO0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLCO2B1 (Solute Carrier Organic Anion Transporter Family, Member 2B1 (SLCO2B1))
- Alternative Name
- SLCO2B1 (SLCO2B1 Products)
- Synonyms
- OATP2B1 antibody, DKFZp469P0119 antibody, im:7158298 antibody, wu:fi40d02 antibody, zgc:123236 antibody, OATP-B antibody, OATPB antibody, SLC21A9 antibody, AI060904 antibody, AI852653 antibody, Slc21a9 antibody, moat1 antibody, solute carrier organic anion transporter family member 2B1 antibody, solute carrier organic anion transporter family, member 2B1 antibody, solute carrier organic anion transporter family member 2B1 L homeolog antibody, solute carrier organic anion transporter family, member 2b1 antibody, SLCO2B1 antibody, slco2b1 antibody, slco2b1.L antibody, Slco2b1 antibody
- Background
- SLCO2B1 mediates the Na+-independent transport of organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost.
- Molecular Weight
- 77 kDa (MW of target protein)
-