ABCC3 antibody
-
- Target See all ABCC3 Antibodies
- ABCC3 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 3 (ABCC3))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ABCC3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ABCC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids KVHMKGSVAYVPQQAWIQNCTLQENVLFGKALNPKRYQQTLEACALLADL
- Top Product
- Discover our top product ABCC3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ABCC3 Blocking Peptide, catalog no. 33R-4707, is also available for use as a blocking control in assays to test for specificity of this ABCC3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCC3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ABCC3 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 3 (ABCC3))
- Alternative Name
- ABCC3 (ABCC3 Products)
- Synonyms
- ABC31 antibody, EST90757 antibody, MLP2 antibody, MOAT-D antibody, MRP3 antibody, cMOAT2 antibody, 1700019L09Rik antibody, Mlp2 antibody, Mrp3 antibody, ATP binding cassette subfamily C member 3 antibody, ATP-binding cassette, sub-family C (CFTR/MRP), member 3 antibody, ABCC3 antibody, Abcc3 antibody
- Background
- ABCC3 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. The specific function of this protein has not yet been determined, however, this protein may play a role in the transport of biliary and intestinal excretion of organic anions. Alternatively spliced variants which encode different protein isoforms have been described, however, not all variants have been fully characterized.
- Molecular Weight
- 168 kDa (MW of target protein)
-