KTN1 antibody

Catalog No. ABIN635282

Product Details anti-KTN1 Antibody

Target: KTN1 (Kinectin 1 (Kinesin Receptor) (KTN1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KTN1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Kinectin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EELLKVISEREKEISGLWNELDSLKDAVEHQRKKNNDLREKNWEAMEALA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Kinectin 1 Blocking Peptide, catalog no. 33R-2373, is also available for use as a blocking control in assays to test for specificity of this Kinectin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KTN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KTN1

Target: KTN1 (Kinectin 1 (Kinesin Receptor) (KTN1))

Alternative Name: Kinectin 1 (KTN1 Products)

Synonyms: cb213 antibody, wu:fi20e02 antibody, wu:fi27f06 antibody, CG1 antibody, KNT antibody, MU-RMS-40.19 antibody, kinectin 1 antibody, kinectin antibody, kinectin 1 L homeolog antibody, Ktn1 antibody, ktn1 antibody, KTN1 antibody, CpipJ_CPIJ006678 antibody, CpipJ_CPIJ006680 antibody, CpipJ_CPIJ007437 antibody, ktn1.L antibody

Background: Various cellular organelles and vesicles are transported along the microtubules in the cytoplasm. Likewise, membrane recycling of the endoplasmic reticulum (ER), Golgi assembly at the microtubule organizing center, and alignment of lysosomes along microtubules are all related processes. The transport of organelles requires a special class of microtubule-associated proteins (MAPs). One of these is the molecular motor kinesin, an ATPase that moves vesicles unidirectionally toward the plus end of the microtubule.

Molecular Weight: 150 kDa (MW of target protein)