ELAPOR1 antibody (N-Term)

Catalog No. ABIN635280

Product Details anti-ELAPOR1 Antibody

Target: ELAPOR1 (Endosome/Lysosome-associated Apoptosis and Autophagy Regulator 1 (ELAPOR1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ELAPOR1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KIAA1324 antibody was raised against the N terminal of KIAA1324

Purification: Affinity purified

Immunogen: KIAA1324 antibody was raised using the N terminal of KIAA1324 corresponding to a region with amino acids PCAEGRYSLGTGIRFDEWDELPHGFASLSANMELDDSAAESTGNCTSSKW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIAA1324 Blocking Peptide, catalog no. 33R-6992, is also available for use as a blocking control in assays to test for specificity of this KIAA1324 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA1324 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ELAPOR1

Target: ELAPOR1 (Endosome/Lysosome-associated Apoptosis and Autophagy Regulator 1 (ELAPOR1))

Alternative Name: KIAA1324 (ELAPOR1 Products)

Synonyms: EIG121 antibody, BB183350 antibody, Kiaa1324 antibody, mKIAA1324 antibody, KIAA1324 antibody, RIKEN cDNA 5330417C22 gene antibody, KIAA1324 antibody, 5330417C22Rik antibody

Background: KIAA1324 belongs to the UPF0577 family. It may play a role as a marker of hyperestrogenic state and estrogen-related type I endometrial carcinoma.

Molecular Weight: 111 kDa (MW of target protein)