Junctophilin 3 antibody (N-Term)

Catalog No. ABIN635279

Product Details anti-Junctophilin 3 Antibody

Target: Junctophilin 3 (JPH3)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Junctophilin 3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Junctophilin 3 antibody was raised against the N terminal of JPH3

Purification: Affinity purified

Immunogen: Junctophilin 3 antibody was raised using the N terminal of JPH3 corresponding to a region with amino acids SSGGRFNFDDGGSYCGGWEDGKAHGHGVCTGPKGQGEYTGSWSHGFEVLG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Junctophilin 3 Blocking Peptide, catalog no. 33R-8805, is also available for use as a blocking control in assays to test for specificity of this Junctophilin 3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JPH3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Junctophilin 3

Target: Junctophilin 3 (JPH3)

Alternative Name: Junctophilin 3 (JPH3 Products)

Synonyms: CAGL237 antibody, HDL2 antibody, JP-3 antibody, JP3 antibody, TNRC22 antibody, Jp3 antibody, fc26e06 antibody, si:ch211-255l14.9 antibody, wu:fc26e06 antibody, junctophilin 3 antibody, JPH3 antibody, Jph3 antibody, jph3 antibody

Background: Junctional complexes between the plasma membrane and endoplasmic/sarcoplasmic reticulum are a common feature of all excitable cell types and mediate cross talk between cell surface and intracellular ion channels. JPH3 is a component of junctional complexes and is composed of a C-terminal hydrophobic segment spanning the endoplasmic/sarcoplasmic reticulum membrane and a remaining cytoplasmic domain that shows specific affinity for the plasma membrane. CAG/CTG repeat expansions at the Huntington's disease (HD)-like 2 locus have been identified in the gene that encodes JPH3 protein.

Molecular Weight: 81 kDa (MW of target protein)