DCST1 antibody (C-Term)

Catalog No. ABIN635257

Product Details anti-DCST1 Antibody

Target: DCST1 (DC-STAMP Domain Containing 1 (DCST1))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DCST1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DCST1 antibody was raised against the C terminal of DCST1

Purification: Affinity purified

Immunogen: DCST1 antibody was raised using the C terminal of DCST1 corresponding to a region with amino acids SYVCRTLDCEAVYCWSCWDDMRQRCPVCTPREELSSSAFSDSNDDTAYAG

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DCST1 Blocking Peptide, catalog no. 33R-8960, is also available for use as a blocking control in assays to test for specificity of this DCST1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCST1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DCST1

Target: DCST1 (DC-STAMP Domain Containing 1 (DCST1))

Alternative Name: DCST1 (DCST1 Products)

Synonyms: Dcst1 antibody, RGD1307756 antibody, A330106H01Rik antibody, DC-STAMP domain containing 1 antibody, DCST1 antibody, dcst1 antibody, Sulku_2582 antibody, Dcst1 antibody

Background: The function of DCST1 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 78 kDa (MW of target protein)