RNF186 antibody (N-Term)

Catalog No. ABIN635255

Product Details anti-RNF186 Antibody

Target: RNF186 (Ring Finger Protein 186 (RNF186))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNF186 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RNF186 antibody was raised against the N terminal of RNF186

Purification: Affinity purified

Immunogen: RNF186 antibody was raised using the N terminal of RNF186 corresponding to a region with amino acids MACTKTLQQSQPISAGATTTTTAVAPAGGHSGSTECDLECLVCREPYSCP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNF186 Blocking Peptide, catalog no. 33R-5617, is also available for use as a blocking control in assays to test for specificity of this RNF186 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF186 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNF186

Target: RNF186 (Ring Finger Protein 186 (RNF186))

Alternative Name: RNF186 (RNF186 Products)

Synonyms: RP11-91K11.1 antibody, 9130020G10Rik antibody, ring finger protein 186 antibody, RNF186 antibody, Rnf186 antibody

Background: The specific function of RNF186 is not yet known.

Molecular Weight: 24 kDa (MW of target protein)