RNF186 antibody (N-Term)
-
- Target See all RNF186 products
- RNF186 (Ring Finger Protein 186 (RNF186))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RNF186 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RNF186 antibody was raised against the N terminal of RNF186
- Purification
- Affinity purified
- Immunogen
- RNF186 antibody was raised using the N terminal of RNF186 corresponding to a region with amino acids MACTKTLQQSQPISAGATTTTTAVAPAGGHSGSTECDLECLVCREPYSCP
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RNF186 Blocking Peptide, catalog no. 33R-5617, is also available for use as a blocking control in assays to test for specificity of this RNF186 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF186 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNF186 (Ring Finger Protein 186 (RNF186))
- Alternative Name
- RNF186 (RNF186 Products)
- Background
- The specific function of RNF186 is not yet known.
- Molecular Weight
- 24 kDa (MW of target protein)
-