PIEZO2 antibody (Middle Region)

Catalog No. ABIN635249

Product Details anti-PIEZO2 Antibody

Target: PIEZO2 (FAM38B) (Family with Sequence Similarity 38, Member B (FAM38B))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PIEZO2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM38 B antibody was raised against the middle region of FAM38

Purification: Affinity purified

Immunogen: FAM38 B antibody was raised using the middle region of FAM38 corresponding to a region with amino acids AGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMDITIILS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM38B Blocking Peptide, catalog no. 33R-1212, is also available for use as a blocking control in assays to test for specificity of this FAM38B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PIEZO2

Target: PIEZO2 (FAM38B) (Family with Sequence Similarity 38, Member B (FAM38B))

Alternative Name: FAM38B (FAM38B Products)

Synonyms: C18orf30 antibody, C18orf58 antibody, FAM38B antibody, FAM38B2 antibody, HsT748 antibody, HsT771 antibody, 5930434P17 antibody, 9030411M15Rik antibody, 9430028L06Rik antibody, Fam38b antibody, Fam38b2 antibody, RGD1306866 antibody, piezo type mechanosensitive ion channel component 2 antibody, piezo-type mechanosensitive ion channel component 2 antibody, PIEZO2 antibody, Piezo2 antibody

Background: The exact function of FAM38B remains unknown.

Molecular Weight: 63 kDa (MW of target protein)