USP48 antibody (C-Term)

Catalog No. ABIN635246

Product Details anti-USP48 Antibody

Target: USP48 (Ubiquitin Specific Peptidase 48 (USP48))

Binding Specificity: C-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This USP48 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: USP48 antibody was raised against the C terminal of USP48

Purification: Affinity purified

Immunogen: USP48 antibody was raised using the C terminal of USP48 corresponding to a region with amino acids PQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKCGKGTHCS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

USP48 Blocking Peptide, catalog no. 33R-7311, is also available for use as a blocking control in assays to test for specificity of this USP48 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of USP48 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for USP48

Target: USP48 (Ubiquitin Specific Peptidase 48 (USP48))

Alternative Name: USP48 (USP48 Products)

Synonyms: RAP1GA1 antibody, USP31 antibody, 2810449C13Rik antibody, AI115503 antibody, BC021769 antibody, D330022K21Rik antibody, Usp31 antibody, synUSP antibody, USP48 antibody, MGC135142 antibody, zgc:112364 antibody, ubiquitin specific peptidase 48 antibody, ubiquitin specific peptidase 31 antibody, USP48 antibody, Usp48 antibody, usp48 antibody, USP31 antibody

Background: USP48 is a protein containing domains that associate it with the peptidase family C19, also known as family 2 of ubiquitin carboxyl-terminal hydrolases. Family members function as deubiquitinating enzymes, recognizing and hydrolyzing the peptide bond at the C-terminal glycine of ubiquitin. Enzymes in peptidase family C19 are involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins.

Molecular Weight: 70 kDa (MW of target protein)