AADACL4 antibody (N-Term)

Catalog No. ABIN635244

Product Details anti-AADACL4 Antibody

Target: AADACL4 (Arylacetamide Deacetylase-Like 4 (AADACL4))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AADACL4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: AADACL4 antibody was raised against the N terminal of AADACL4

Purification: Affinity purified

Immunogen: AADACL4 antibody was raised using the N terminal of AADACL4 corresponding to a region with amino acids FIRFLHDSVRIKKDPELVVTDLRFGTIPVRLFQPKAASSRPRRGIIFYHG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AADACL4 Blocking Peptide, catalog no. 33R-2935, is also available for use as a blocking control in assays to test for specificity of this AADACL4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AADACL4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AADACL4

Target: AADACL4 (Arylacetamide Deacetylase-Like 4 (AADACL4))

Alternative Name: AADACL4 (AADACL4 Products)

Synonyms: RGD1565761 antibody, OTTMUSG00000010747 antibody, Aadacl4 antibody, arylacetamide deacetylase like 4 antibody, arylacetamide deacetylase-like 4 S homeolog antibody, arylacetamide deacetylase-like 4 antibody, arylacetamide deacetylase-like 4-like 3 antibody, AADACL4 antibody, aadacl4.S antibody, aadacl4 antibody, Aadacl4 antibody, AADACL4L3 antibody, LOC100218769 antibody, LOC100713568 antibody

Background: The function of AADAC protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 46 kDa (MW of target protein)