RNF139 antibody (N-Term)
-
- Target See all RNF139 Antibodies
- RNF139 (Ring Finger Protein 139 (RNF139))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RNF139 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RNF139 antibody was raised against the N terminal of RNF139
- Purification
- Affinity purified
- Immunogen
- RNF139 antibody was raised using the N terminal of RNF139 corresponding to a region with amino acids SQRSLFKFYTYSSAFLLAATSVLVNYYASLHIDFYGAYNTSAFGIELLPR
- Top Product
- Discover our top product RNF139 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RNF139 Blocking Peptide, catalog no. 33R-8723, is also available for use as a blocking control in assays to test for specificity of this RNF139 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF139 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNF139 (Ring Finger Protein 139 (RNF139))
- Alternative Name
- RNF139 (RNF139 Products)
- Background
- RNF139 is a multi-membrane spanning protein containing a RING-H2 finger. This protein is located in the endoplasmic reticulum, and has been shown to possess ubiquitin ligase activity. This gene was found to be interrupted by a t(3:8) translocation in a family with hereditary renal and non-medulary thyroid cancer. Studies of the Drosophila counterpart suggested that this protein may interact with tumor suppressor protein VHL, as well as with COPS5/JAB1, a protein responsible for the degradation of tumor suppressor CDKN1B/P27KIP.
- Molecular Weight
- 76 kDa (MW of target protein)
-