RNF139 antibody (N-Term)

Catalog No. ABIN635236

Product Details anti-RNF139 Antibody

Target: RNF139 (Ring Finger Protein 139 (RNF139))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNF139 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RNF139 antibody was raised against the N terminal of RNF139

Purification: Affinity purified

Immunogen: RNF139 antibody was raised using the N terminal of RNF139 corresponding to a region with amino acids SQRSLFKFYTYSSAFLLAATSVLVNYYASLHIDFYGAYNTSAFGIELLPR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNF139 Blocking Peptide, catalog no. 33R-8723, is also available for use as a blocking control in assays to test for specificity of this RNF139 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF139 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNF139

Target: RNF139 (Ring Finger Protein 139 (RNF139))

Alternative Name: RNF139 (RNF139 Products)

Synonyms: HRCA1 antibody, RCA1 antibody, TRC8 antibody, 4930555P18Rik antibody, zgc:175173 antibody, rnf139 antibody, ring finger protein 139 antibody, ring finger protein 139 S homeolog antibody, RNF139 antibody, Rnf139 antibody, rnf139 antibody, rnf139.S antibody

Background: RNF139 is a multi-membrane spanning protein containing a RING-H2 finger. This protein is located in the endoplasmic reticulum, and has been shown to possess ubiquitin ligase activity. This gene was found to be interrupted by a t(3:8) translocation in a family with hereditary renal and non-medulary thyroid cancer. Studies of the Drosophila counterpart suggested that this protein may interact with tumor suppressor protein VHL, as well as with COPS5/JAB1, a protein responsible for the degradation of tumor suppressor CDKN1B/P27KIP.

Molecular Weight: 76 kDa (MW of target protein)