BACE2 antibody (N-Term)
-
- Target See all BACE2 Antibodies
- BACE2 (beta-Site APP-Cleaving Enzyme 2 (BACE2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This BACE2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- BACE2 antibody was raised against the N terminal of BACE2
- Purification
- Affinity purified
- Immunogen
- BACE2 antibody was raised using the N terminal of BACE2 corresponding to a region with amino acids PAGAANFLAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAVAG
- Top Product
- Discover our top product BACE2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
BACE2 Blocking Peptide, catalog no. 33R-6958, is also available for use as a blocking control in assays to test for specificity of this BACE2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BACE2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BACE2 (beta-Site APP-Cleaving Enzyme 2 (BACE2))
- Alternative Name
- BACE2 (BACE2 Products)
- Background
- Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease and a frequent complication of Down syndrome. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein by 2 proteases, one of which is the protein encoded by this gene. This gene localizes to the 'Down critical region' of chromosome 21. The encoded protein, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease. Three transcript variants encoding different isoforms have been described for this gene.
- Molecular Weight
- 37 kDa (MW of target protein)
-