SLC35D3 antibody (N-Term)
-
- Target See all SLC35D3 Antibodies
- SLC35D3 (Solute Carrier Family 35, Member D3 (SLC35D3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC35D3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SLC35 D3 antibody was raised against the N terminal of SLC35 3
- Purification
- Affinity purified
- Immunogen
- SLC35 D3 antibody was raised using the N terminal of SLC35 3 corresponding to a region with amino acids RYQFSFLTLVQCLTSSTAALSLELLRRLGLIAVPPFGLSLARSFAGVAVL
- Top Product
- Discover our top product SLC35D3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC35D3 Blocking Peptide, catalog no. 33R-8281, is also available for use as a blocking control in assays to test for specificity of this SLC35D3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC35D3 (Solute Carrier Family 35, Member D3 (SLC35D3))
- Alternative Name
- SLC35D3 (SLC35D3 Products)
- Synonyms
- FRCL1 antibody, bA55K22.3 antibody, 6230421J19Rik antibody, Frcl1 antibody, solute carrier family 35, member D3 antibody, solute carrier family 35 member D3 antibody, Slc35d3 antibody, SLC35D3 antibody, slc35d3 antibody
- Background
- SLC35D3 may play a role in hemostasis as a regulator of the biosynthesis of platelet-dense granules.
- Molecular Weight
- 44 kDa (MW of target protein)
-