Fc epsilon RI/FCER1A antibody (N-Term)
-
- Target See all Fc epsilon RI/FCER1A (FCER1A) Antibodies
- Fc epsilon RI/FCER1A (FCER1A) (Fc Fragment of IgE Receptor Ia (FCER1A))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Fc epsilon RI/FCER1A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FCER1 A antibody was raised against the N terminal of FCER1
- Purification
- Affinity purified
- Immunogen
- FCER1 A antibody was raised using the N terminal of FCER1 corresponding to a region with amino acids NPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAK
- Top Product
- Discover our top product FCER1A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FCER1A Blocking Peptide, catalog no. ABIN5613559, is also available for use as a blocking control in assays to test for specificity of this FCER1A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FCER0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Fc epsilon RI/FCER1A (FCER1A) (Fc Fragment of IgE Receptor Ia (FCER1A))
- Alternative Name
- FCER1A (FCER1A Products)
- Background
- The IgE receptor plays a central role in allergic disease, coupling allergen and mast cell to initiate the inflammatory and immediate hypersensitivity responses that are characteristic of disorders such as hay fever and asthma. The allergic response occurs when 2 or more high-affinity IgE receptors are crosslinked via IgE molecules that in turn are bound to an allergen (antigen) molecule.
- Molecular Weight
- 27 kDa (MW of target protein)
- Pathways
- Fc-epsilon Receptor Signaling Pathway, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process
-