Fc epsilon RI/FCER1A antibody (N-Term)

Catalog No. ABIN635223

Product Details anti-Fc epsilon RI/FCER1A Antibody

Target: Fc epsilon RI/FCER1A (FCER1A) (Fc Fragment of IgE Receptor Ia (FCER1A))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Fc epsilon RI/FCER1A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FCER1 A antibody was raised against the N terminal of FCER1

Purification: Affinity purified

Immunogen: FCER1 A antibody was raised using the N terminal of FCER1 corresponding to a region with amino acids NPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FCER1A Blocking Peptide, catalog no. ABIN5613559, is also available for use as a blocking control in assays to test for specificity of this FCER1A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FCER0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Fc epsilon RI/FCER1A

Target: Fc epsilon RI/FCER1A (FCER1A) (Fc Fragment of IgE Receptor Ia (FCER1A))

Alternative Name: FCER1A (FCER1A Products)

Synonyms: FCER1A antibody, FCE1A antibody, FcERI antibody, Iger01 antibody, RATIGER01 antibody, Fce1a antibody, Fcr-5 antibody, fcepsilonri antibody, Fc fragment of IgE receptor Ia antibody, Fc receptor, IgE, high affinity I, alpha polypeptide antibody, FCER1A antibody, Fcer1a antibody

Background: The IgE receptor plays a central role in allergic disease, coupling allergen and mast cell to initiate the inflammatory and immediate hypersensitivity responses that are characteristic of disorders such as hay fever and asthma. The allergic response occurs when 2 or more high-affinity IgE receptors are crosslinked via IgE molecules that in turn are bound to an allergen (antigen) molecule.

Molecular Weight: 27 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process