TMEM166 antibody (N-Term)

Catalog No. ABIN635222

Product Details anti-TMEM166 Antibody

Target: TMEM166 (FAM176A) (Family with Sequence Similarity 176, Member A (FAM176A))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM166 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM166 antibody was raised against the N terminal Of Tmem166

Purification: Affinity purified

Immunogen: TMEM166 antibody was raised using the N terminal Of Tmem166 corresponding to a region with amino acids RLPLSHSPEHVEMALLSNILAAYSFVSENPERAALYFVSGVCIGLVLTLA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM166 Blocking Peptide, catalog no. 33R-8044, is also available for use as a blocking control in assays to test for specificity of this TMEM166 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM166 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM166

Target: TMEM166 (FAM176A) (Family with Sequence Similarity 176, Member A (FAM176A))

Alternative Name: TMEM166 (FAM176A Products)

Synonyms: Fam176a antibody, RGD1559797 antibody, Tmem166 antibody, FAM176A antibody, TMEM166 antibody, BC014699 antibody, eva-1 homolog A, regulator of programmed cell death antibody, eva-1 homolog A (C. elegans) antibody, Eva1a antibody, EVA1A antibody

Background: TMEM166 belongs to the FAM176 family. It acts as a regulator of programmed cell death, mediating both autophagy and apoptosis.

Molecular Weight: 17 kDa (MW of target protein)