TCTN3 antibody (Middle Region)
-
- Target See all TCTN3 Antibodies
- TCTN3 (Tectonic Family Member 3 (TCTN3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TCTN3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TCTN3 antibody was raised against the middle region of TCTN3
- Purification
- Affinity purified
- Immunogen
- TCTN3 antibody was raised using the middle region of TCTN3 corresponding to a region with amino acids LTYFPKWSVISLLRQPAGVGAGGLCAESNPAGFLESKSTTCTRFFKNLAS
- Top Product
- Discover our top product TCTN3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TCTN3 Blocking Peptide, catalog no. 33R-5493, is also available for use as a blocking control in assays to test for specificity of this TCTN3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCTN3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TCTN3 (Tectonic Family Member 3 (TCTN3))
- Alternative Name
- TCTN3 (TCTN3 Products)
- Synonyms
- RGD1305166 antibody, C10orf61 antibody, JBTS18 antibody, OFD4 antibody, TECT3 antibody, 4930521E07Rik antibody, AI197391 antibody, Tect3 antibody, tectonic family member 3 antibody, Tctn3 antibody, TCTN3 antibody
- Background
- TCTN3 may be involved in apoptosis regulation.
- Molecular Weight
- 64 kDa (MW of target protein)
-