PIGQ antibody (N-Term)

Catalog No. ABIN635220

Product Details anti-PIGQ Antibody

Target: PIGQ (Phosphatidylinositol Glycan Anchor Biosynthesis, Class Q (PIGQ))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PIGQ antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PIGQ antibody was raised against the N terminal of PIGQ

Purification: Affinity purified

Immunogen: PIGQ antibody was raised using the N terminal of PIGQ corresponding to a region with amino acids PTVLPDRQAGATTASTGGLAAVFDTVARSEVLFRSDRFDEGPVRLSHWQS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PIGQ Blocking Peptide, catalog no. 33R-7400, is also available for use as a blocking control in assays to test for specificity of this PIGQ antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGQ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PIGQ

Target: PIGQ (Phosphatidylinositol Glycan Anchor Biosynthesis, Class Q (PIGQ))

Alternative Name: PIGQ (PIGQ Products)

Synonyms: GPI1 antibody, c407A10.1 antibody, Gpi1 antibody, Gpi1h antibody, Gpi1p antibody, Gpih antibody, phosphatidylinositol glycan anchor biosynthesis class Q antibody, phosphatidylinositol glycan anchor biosynthesis, class Q antibody, PIGQ antibody, Pigq antibody

Background: PIGQ is involved in the first step in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. PIGQ is a N-acetylglucosaminyl transferase component that is part of the complex that catalyzes transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc to phosphatidylinositol (PI).

Molecular Weight: 65 kDa (MW of target protein)

Pathways: Inositol Metabolic Process