LASS1 antibody (Middle Region)

Catalog No. ABIN635214

Product Details anti-LASS1 Antibody

Target: LASS1 (CERS1) (Ceramide Synthase 1 (CERS1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LASS1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LASS1 antibody was raised against the middle region of LASS1

Purification: Affinity purified

Immunogen: LASS1 antibody was raised using the middle region of LASS1 corresponding to a region with amino acids LYIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LASS1 Blocking Peptide, catalog no. 33R-5564, is also available for use as a blocking control in assays to test for specificity of this LASS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LASS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LASS1

Target: LASS1 (CERS1) (Ceramide Synthase 1 (CERS1))

Alternative Name: LASS1 (CERS1 Products)

Synonyms: LAG1 antibody, LASS1 antibody, UOG1 antibody, Lass1 antibody, Uog-1 antibody, to antibody, LAG1 HOMOLOG 1 antibody, LONGEVITY ASSURANCE GENE 1 antibody, ceramide synthase 1 antibody, TRAM, LAG1 and CLN8 (TLC) lipid-sensing domain containing protein antibody, CERS1 antibody, Cers1 antibody, LAG1 antibody

Background: This gene encodes a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily.

Molecular Weight: 39 kDa (MW of target protein)