INSIG1 antibody (Middle Region)
-
- Target See all INSIG1 Antibodies
- INSIG1 (Insulin Induced Gene 1 (INSIG1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This INSIG1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- INSIG1 antibody was raised against the middle region of INSIG1
- Purification
- Affinity purified
- Immunogen
- INSIG1 antibody was raised using the middle region of INSIG1 corresponding to a region with amino acids ITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGR
- Top Product
- Discover our top product INSIG1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
INSIG1 Blocking Peptide, catalog no. 33R-4178, is also available for use as a blocking control in assays to test for specificity of this INSIG1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INSIG1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- INSIG1 (Insulin Induced Gene 1 (INSIG1))
- Alternative Name
- INSIG1 (INSIG1 Products)
- Synonyms
- cl-6 antibody, cl6 antibody, CL-6 antibody, CL6 antibody, fb55a03 antibody, fi35b10 antibody, wu:fb55a03 antibody, wu:fi35b10 antibody, zgc:55439 antibody, 1810013C12Rik antibody, Insig-1 antibody, INSIG-1 antibody, insulin induced gene 1 antibody, insulin induced gene 1 L homeolog antibody, INSIG1 antibody, insig1 antibody, insig1.L antibody, Insig1 antibody
- Background
- Oxysterols regulate cholesterol homeostasis through the liver X receptor (LXR)- and sterol regulatory element-binding protein (SREBP)-mediated signaling pathways. This gene is an insulin-induced gene.
- Molecular Weight
- 36 kDa (MW of target protein)
- Pathways
- ER-Nucleus Signaling
-