TRAF3IP3 antibody (Middle Region)
-
- Target See all TRAF3IP3 Antibodies
- TRAF3IP3 (TRAF3 Interacting Protein 3 (TRAF3IP3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TRAF3IP3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TRAF3 IP3 antibody was raised against the middle region of TRAF3 P3
- Purification
- Affinity purified
- Immunogen
- TRAF3 IP3 antibody was raised using the middle region of TRAF3 P3 corresponding to a region with amino acids KQKMVILQDLLSTLIQASDSSWKGQLNEDKLKGKLRSLENQLYTCTQKYS
- Top Product
- Discover our top product TRAF3IP3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TRAF3IP3 Blocking Peptide, catalog no. 33R-4606, is also available for use as a blocking control in assays to test for specificity of this TRAF3IP3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAF0 P3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRAF3IP3 (TRAF3 Interacting Protein 3 (TRAF3IP3))
- Alternative Name
- TRAF3IP3 (TRAF3IP3 Products)
- Synonyms
- DJ434O14.3 antibody, T3JAM antibody, 6030423D04Rik antibody, AI115021 antibody, T3jam antibody, RGD1304848 antibody, TRAF3 interacting protein 3 antibody, TRAF3IP3 antibody, Traf3ip3 antibody
- Background
- TRAF3IP3 stimulated cell growth by modulating the c-Jun N-terminal kinase (JNK) pathway. TRAF3 interacts with Smac/DIABLO via TRAF domain, leading to an increased proapoptotic effect of Smac/DIABLO in cytoplasm.
- Molecular Weight
- 61 kDa (MW of target protein)
-