HERPUD2 antibody (N-Term)

Catalog No. ABIN635204

Product Details anti-HERPUD2 Antibody

Target: HERPUD2 (HERPUD Family Member 2 (HERPUD2))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HERPUD2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HERPUD2 antibody was raised against the N terminal of HERPUD2

Purification: Affinity purified

Immunogen: HERPUD2 antibody was raised using the N terminal of HERPUD2 corresponding to a region with amino acids MDQSGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HERPUD2 Blocking Peptide, catalog no. 33R-5864, is also available for use as a blocking control in assays to test for specificity of this HERPUD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HERPUD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HERPUD2

Target: HERPUD2 (HERPUD Family Member 2 (HERPUD2))

Alternative Name: HERPUD2 (HERPUD2 Products)

Synonyms: zgc:56020 antibody, zgc:76968 antibody, 5031400M07Rik antibody, AB041580 antibody, RGD1307343 antibody, HERPUD family member 2 antibody, HERPUD family member 2 L homeolog antibody, herpud2 antibody, HERPUD2 antibody, Herpud2 antibody, herpud2.L antibody

Background: HERPUD2 could be involved in the unfolded protein response (UPR) pathway.

Molecular Weight: 45 kDa (MW of target protein)