GCS1 antibody (N-Term)

Catalog No. ABIN635202

Product Details anti-GCS1 Antibody

Target: GCS1 (MOGS) (Mannosyl-Oligosaccharide Glucosidase (MOGS))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GCS1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GCS1 antibody was raised against the N terminal of GCS1

Purification: Affinity purified

Immunogen: GCS1 antibody was raised using the N terminal of GCS1 corresponding to a region with amino acids GPYGWEFHDGLSFGRQHIQDGALRLTTEFVKRPGGQHGGDWSWRVTVEPQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GCS1 Blocking Peptide, catalog no. 33R-3486, is also available for use as a blocking control in assays to test for specificity of this GCS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GCS1

Target: GCS1 (MOGS) (Mannosyl-Oligosaccharide Glucosidase (MOGS))

Alternative Name: GCS1 (MOGS Products)

Synonyms: Afu6g04210 antibody, AO090701000141 antibody, Mogs antibody, CDG2B antibody, CWH41 antibody, DER7 antibody, GCS1 antibody, 1810017N02Rik antibody, AI181835 antibody, Gcs1 antibody, gcs1 antibody, im:7160827 antibody, wu:fe50a12 antibody, wu:fk09a10 antibody, zgc:158312 antibody, mannosyl-oligosaccharide glucosidase antibody, mannosyl-oligosaccharide glucosidase GCS1 antibody, mannosyl-oligosaccharide glucosidase L homeolog antibody, mannosyl oligosaccharide glucosidase antibody, glucosidase 1 antibody, AFUA_6G04210 antibody, Tc00.1047053511015.10 antibody, Tc00.1047053511805.10 antibody, LOC5576381 antibody, AOR_1_260114 antibody, MGYG_00305 antibody, TERG_01248 antibody, mogs.L antibody, TTHERM_00636930 antibody, LOAG_03690 antibody, Gcs1 antibody, MOGS antibody, Mogs antibody, mogs antibody

Background: GCS1 is the first enzyme in the N-linked oligosaccharide processing pathway. The enzyme cleaves the distal alpha-1,2-linked glucose residue from the Glc(3)-Man(9)-GlcNAc(2) oligosaccharide precursor. This protein is located in the lumen of the endoplasmic reticulum.

Molecular Weight: 92 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome