GCS1 antibody (N-Term)
-
- Target See all GCS1 (MOGS) Antibodies
- GCS1 (MOGS) (Mannosyl-Oligosaccharide Glucosidase (MOGS))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GCS1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GCS1 antibody was raised against the N terminal of GCS1
- Purification
- Affinity purified
- Immunogen
- GCS1 antibody was raised using the N terminal of GCS1 corresponding to a region with amino acids GPYGWEFHDGLSFGRQHIQDGALRLTTEFVKRPGGQHGGDWSWRVTVEPQ
- Top Product
- Discover our top product MOGS Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GCS1 Blocking Peptide, catalog no. 33R-3486, is also available for use as a blocking control in assays to test for specificity of this GCS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GCS1 (MOGS) (Mannosyl-Oligosaccharide Glucosidase (MOGS))
- Alternative Name
- GCS1 (MOGS Products)
- Background
- GCS1 is the first enzyme in the N-linked oligosaccharide processing pathway. The enzyme cleaves the distal alpha-1,2-linked glucose residue from the Glc(3)-Man(9)-GlcNAc(2) oligosaccharide precursor. This protein is located in the lumen of the endoplasmic reticulum.
- Molecular Weight
- 92 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-