KREMEN1 antibody (N-Term)

Catalog No. ABIN635197

Product Details anti-KREMEN1 Antibody

Target: KREMEN1 (Kringle Containing Transmembrane Protein 1 (KREMEN1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KREMEN1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KREMEN1 antibody was raised against the N terminal of KREMEN1

Purification: Affinity purified

Immunogen: KREMEN1 antibody was raised using the N terminal of KREMEN1 corresponding to a region with amino acids WKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKTSNKLTIQTCISFCRSQR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KREMEN1 Blocking Peptide, catalog no. 33R-9967, is also available for use as a blocking control in assays to test for specificity of this KREMEN1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KREMEN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KREMEN1

Target: KREMEN1 (Kringle Containing Transmembrane Protein 1 (KREMEN1))

Alternative Name: KREMEN1 (KREMEN1 Products)

Synonyms: KREMEN1 antibody, krm1 antibody, kremen antibody, kremem1 antibody, KREMEN antibody, KRM1 antibody, AV002070 antibody, Kremen antibody, Krm1 antibody, si:ct737139.1 antibody, si:dkeyp-7c9.1 antibody, kringle containing transmembrane protein 1 antibody, kringle containing transmembrane protein 1 S homeolog antibody, KREMEN1 antibody, kremen1 antibody, Kremen1 antibody, kremen1.S antibody

Background: KREMEN1 is a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functionally cooperates with DKK1 to block wingless (WNT)/beta-catenin signaling. It is a component of a membrane complex that modulates canonical WNT signaling through lipoprotein receptor-related protein 6 (LRP6). It contains extracellular kringle, WSC, and CUB domains.

Molecular Weight: 50 kDa (MW of target protein)

Pathways: WNT Signaling