Calsyntenin 3 antibody (N-Term)

Catalog No. ABIN635191

Product Details anti-Calsyntenin 3 Antibody

Target: Calsyntenin 3 (CLSTN3)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Calsyntenin 3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Calsyntenin 3 antibody was raised against the N terminal of CLSTN3

Purification: Affinity purified

Immunogen: Calsyntenin 3 antibody was raised using the N terminal of CLSTN3 corresponding to a region with amino acids QICYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Calsyntenin 3 Blocking Peptide, catalog no. 33R-7585, is also available for use as a blocking control in assays to test for specificity of this Calsyntenin 3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLSTN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Calsyntenin 3

Target: Calsyntenin 3 (CLSTN3)

Alternative Name: Calsyntenin 3 (CLSTN3 Products)

Synonyms: cstn3 antibody, cdhr14 antibody, alcbeta antibody, MGC84020 antibody, CDHR14 antibody, CSTN3 antibody, Cs3 antibody, Cst-3 antibody, mKIAA0726 antibody, Cstn3 antibody, calsyntenin 3 antibody, calsyntenin 3 S homeolog antibody, CLSTN3 antibody, clstn3.S antibody, Clstn3 antibody

Background: CLSTN3 may modulate calcium-mediated postsynaptic signals. Complex formation with APBA2 and APP,CLSTN3 stabilizes APP metabolism and enhances APBA2-mediated suppression of beta-APP40 secretion, due to the retardation of intracellular APP maturation.

Molecular Weight: 106 kDa (MW of target protein)