PEX11A antibody (Middle Region)
-
- Target See all PEX11A Antibodies
- PEX11A (Peroxisomal Biogenesis Factor 11 alpha (PEX11A))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PEX11A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PEX11 A antibody was raised against the middle region of PEX11
- Purification
- Affinity purified
- Immunogen
- PEX11 A antibody was raised using the middle region of PEX11 corresponding to a region with amino acids MKRVTCDRAKKEKSASQDPLWFSVAEEETEWLQSFLLLLFRSLKQHPPLL
- Top Product
- Discover our top product PEX11A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PEX11A Blocking Peptide, catalog no. 33R-6165, is also available for use as a blocking control in assays to test for specificity of this PEX11A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEX10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PEX11A (Peroxisomal Biogenesis Factor 11 alpha (PEX11A))
- Alternative Name
- PEX11A (PEX11A Products)
- Synonyms
- PEX11-ALPHA antibody, PMP28 antibody, hsPEX11p antibody, PEX11alpha antibody, Pmp26p antibody, T2E6.18 antibody, T2E6_18 antibody, peroxin 11A antibody, peroxisomal biogenesis factor 11 alpha antibody, peroxin 11A antibody, PEX11A antibody, Pex11a antibody
- Background
- PEX11A belongs to the peroxin-11 family. It may be involved in peroxisomal proliferation and may regulate peroxisomes division. PEX11A may mediate binding of coatomer proteins to the peroxisomal membrane.
- Molecular Weight
- 28 kDa (MW of target protein)
- Pathways
- Regulation of Lipid Metabolism by PPARalpha, Brown Fat Cell Differentiation
-