-
- Target See all IgA Antibodies
- IgA
- Binding Specificity
- Middle Region
- Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IgA antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PIGA antibody was raised against the middle region of PIGA
- Purification
- Affinity purified
- Immunogen
- PIGA antibody was raised using the middle region of PIGA corresponding to a region with amino acids SVKSLCEGLEKAIFQLKSGTLPAPENIHNIVKTFYTWRNVAERTEKVYDR
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PIGA Blocking Peptide, catalog no. 33R-8916, is also available for use as a blocking control in assays to test for specificity of this PIGA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IgA
- Abstract
- IgA Products
- Synonyms
- MB-1 antibody, IG-alpha antibody, IGA antibody, IgA antibody, Igh-2 antibody, CD79a molecule antibody, immunoglobulin heavy constant alpha antibody, CD79A antibody, Igha antibody
- Target Type
- Antibody
- Background
- PIGA is a protein required for synthesis of N-acetylglucosaminyl phosphatidylinositol (GlcNAc-PI), the first intermediate in the biosynthetic pathway of GPI anchor. The GPI anchor is a glycolipid found on many blood cells and which serves to anchor proteins to the cell surface. Paroxysmal nocturnal hemoglobinuria, an acquired hematologic disorder, has been shown to result from mutations in this gene.
- Molecular Weight
- 19 kDa (MW of target protein)
-
You are here:
