LRRC26 antibody (Middle Region)

Catalog No. ABIN635168

Product Details anti-LRRC26 Antibody

Target: LRRC26 (Leucine Rich Repeat Containing 26 (LRRC26))

Binding Specificity: Middle Region

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRRC26 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LRRC26 antibody was raised against the middle region of Lrrc26

Purification: Affinity purified

Immunogen: LRRC26 antibody was raised using the middle region of Lrrc26 corresponding to a region with amino acids LRPLCAWLRRHPLPASEAETVLCVWPGRLTLSPLTAFSDAAFSHCAQPLA

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRRC26 Blocking Peptide, catalog no. 33R-5378, is also available for use as a blocking control in assays to test for specificity of this LRRC26 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC26 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRRC26

Target: LRRC26 (Leucine Rich Repeat Containing 26 (LRRC26))

Alternative Name: LRRC26 (LRRC26 Products)

Synonyms: LRRC26 antibody, CAPC antibody, bA350O14.10 antibody, RP23-132N23.19 antibody, RGD1308398 antibody, leucine rich repeat containing 26 antibody, LRRC26 antibody, Lrrc26 antibody

Background: LRRC26 is an auxiliary protein of the large-conductance, voltage and calcium-activated potassium channel (BK alpha), required for the conversion of BK alpha channels from a high-voltage to a low-voltage activated channel type in non-excitable cells. These are characterized by negative membrane voltages and constant low levels of calcium.

Molecular Weight: 37 kDa (MW of target protein)