INSIG1 antibody (Middle Region)

Catalog No. ABIN635167

Product Details anti-INSIG1 Antibody

Target: INSIG1 (Insulin Induced Gene 1 (INSIG1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This INSIG1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: INSIG1 antibody was raised against the middle region of INSIG1

Purification: Affinity purified

Immunogen: INSIG1 antibody was raised using the middle region of INSIG1 corresponding to a region with amino acids WWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

INSIG1 Blocking Peptide, catalog no. 33R-10042, is also available for use as a blocking control in assays to test for specificity of this INSIG1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INSIG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for INSIG1

Target: INSIG1 (Insulin Induced Gene 1 (INSIG1))

Alternative Name: INSIG1 (INSIG1 Products)

Synonyms: cl-6 antibody, cl6 antibody, CL-6 antibody, CL6 antibody, fb55a03 antibody, fi35b10 antibody, wu:fb55a03 antibody, wu:fi35b10 antibody, zgc:55439 antibody, 1810013C12Rik antibody, Insig-1 antibody, INSIG-1 antibody, insulin induced gene 1 antibody, insulin induced gene 1 L homeolog antibody, INSIG1 antibody, insig1 antibody, insig1.L antibody, Insig1 antibody

Background: Oxysterols regulate cholesterol homeostasis through the liver X receptor (LXR)- and sterol regulatory element-binding protein (SREBP)-mediated signaling pathways. This gene is an insulin-induced gene. INSIG1 is an endoplasmic reticulum (ER) membrane protein that plays a critical role in regulating cholesterol concentrations in cells. INSIG1 binds to the sterol-sensing domains of SREBP cleavage-activating protein (SCAP) and HMG CoA reductase, and is essential for the sterol-mediated trafficking of the two proteins.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling